
Webkatalog - Artikelverzeichnis » Reisen

Webverzeichnis Menü

Link eintragen
Webkatalog Home
Neue Links
Populärste Links
Featured Links
Webkatalog FAQ
Link zu uns
Kategorie vorschlagen

Zufrieden mit uns?

RSS - letzte Freischaltungen  RSS - Top Einträge


Artikel & News
Artikel schreiben

Seiten Info

Kategorien: 430
Aktive Links: 10613
Feature-Links: 18
Backlinks: 264
Links heute: 0
Links gestern: 0
letzten 7 Tage: 0
wartende Links: 7
Aktive Artikel: 920
Artikel heute: 0

Besucher gesamt: 1.145.850
Besucher heute: 46
Besucher gestern: 235
max.User/Tag 879
gerade online: 13
Seitenaufrufe gesamt: 30.143.259
Hits diese Page 25.357
Counterstart: 07.08.2008
Tools & Service

Linkpreis Kalkulator
Webseiten - Verkauf
Mozilla Firefox 3


Heute wurden alle eingetragenen Webseiten auf Erreichbarkeit geprüft. 535 fehlerhafte URL´s sowie 32 Webseiten nach Backlinkcheck wurden aus dem Webverzeichnis gelöscht.

Apache HTTP Server Test Page powered by CentOS

Apache 2 Test Page
powered by CentOS

This page is used to test the proper operation of the Apache HTTP server after it has been installed. If you can read this page it means that the Apache HTTP server installed at this site is working properly.

If you are a member of the general public:

The fact that you are seeing this page indicates that the website you just visited is either experiencing problems or is undergoing routine maintenance.

If you would like to let the administrators of this website know that you've seen this page instead of the page you expected, you should send them e-mail. In general, mail sent to the name "webmaster" and directed to the website's domain should reach the appropriate person.

For example, if you experienced problems while visiting, you should send e-mail to "".

If you are the website administrator:

You may now add content to the directory /var/www/html/. Note that until you do so, people visiting your website will see this page and not your content. To prevent this page from ever being used, follow the instructions in the file /etc/httpd/conf.d/welcome.conf.

You are free to use the images below on Apache and CentOS Linux powered HTTP servers. Thanks for using Apache and CentOS!

[ Powered by Apache ] [ Powered by CentOS Linux ]

About CentOS:

The Community ENTerprise Operating System (CentOS) Linux is a community-supported enterprise distribution derived from sources freely provided to the public by Red Hat. As such, CentOS Linux aims to be functionally compatible with Red Hat Enterprise Linux. The CentOS Project is the organization that builds CentOS. We mainly change packages to remove upstream vendor branding and artwork.

For information on CentOS please visit the CentOS website.


CentOS is an Operating System and it is used to power this website; however, the webserver is owned by the domain owner and not the CentOS Project. If you have issues with the content of this site, contact the owner of the domain, not the CentOS Project.

Unless this server is on the domain, the CentOS Project doesn't have anything to do with the content on this webserver or any e-mails that directed you to this site.

For example, if this website is, you would find the owner of the domain at the following WHOIS server:


Camping (23)
Hotels (240)

Der Begriff Reise (v. althochdeutsch: risan = aufstehen, sich erheben) bedeutet im Sinne der Verkehrswirtschaft die Fortbewewegung einer oder mehrerer Personen über eine längere Zeit zu Fuß oder mit öffentlichen bzw. nicht öffentlichen Verkehrsmitteln außerhalb des Wirtschaftsverkehrs, um ein Reiseziel zu erreichen oder mehrere Orte bis zur Beendigung der Reise am Ausgangsort kennenzulernen (Rundreise). Im fremdenverkehrswirtschaftlichen Sinne umfasst die Bezeichnung Reise die Summe der beiden Phasen "Ortsveränderung" und Aufenthalt. Die verwendeten Verkehrsmittel bilden hierbei eine Gesamtheit: Die Reisekette (Beispiel: Bus – Flugzeug – Straßenbahn – Taxi). Grundsätzlich unternimmt man Reisen für den Geschäftszweck oder aber Privat. Um eine Reise zu buchen stehen mehrere Möglichkeiten zur Auswahl. Zum einen bieten sich Reisebüros an, aber auch Online-Reiseportale, die viele Reiseberichte und Reiseinformationen für den Kunden bereit stellen. Die Vorteile eines Reisebüros mit seiner individuellen Beratung sind dabei nicht zu unterschätzen. Dagegen muß man sich als Reisesuchender im Internet meistens allein durcharbeiten um die passenden Reise-Angebote ausfindig zu machen. Obwohl die Online-Reiseportale eine gute Übersicht besitzen, ist es meist schwierig das Passende zu finden, sei es die richtige Wahl eines Hotels, einer Pension, einer Ferienwohnung oder Ferienhaus. Reiseveranstalter bieten ein umfangreiches Angebot an Reisen an: Busreisen, Abenteuerreisen, Tagesreisen oder Lastminute-Reisen. Die Auswahl ist groß. In den letzten Jahren haben sich Kreuzfahrten zu einem Lieblingsthema bei Reisen entwickelt. Reisen auf einem Kreufahrtschiff sind heutzutage für alle Ecken der Welt zu buchen. Ebenso ensteht ein neuer Trend im Inland: Urlaub auf einem Bauernhof. Diese Art Urlaub nutzen vor allem Großstädter, die dem Stress der Metropolen entfliehen wollen. Eine solche Reise kann bequem als Busreise oder aber auch mit dem privatem PKW durchgeführt werden. Die deutschen Bundesländer im Norden haben in den letzten Jahren stetig steigende Besucher zu melden. Das die norddeutschen Reiseländer so gut in der Gunst von Reisenden sind, zeugt von einer gut ausgebauten Infrastruktur, die ständig verbessert wurde. So wurden unter anderem Campingplätze ausgebaut oder erweitert, zusätzliche Fahrradwege gebaut oder aber auch die Freizeitangebote in den Ferienorten ausgebaut. Parallel bleibt aber trotzdem die Reiselust in wärmere Urlaubsorte der Welt erhalten - Flug online buchen und ab in den Süden. Beliebte Reiseziele sind immer noch Mallorca, Ägypten oder die Kanarischen Inseln. Beflügelt wird die Reiselust von billigen Flugangeboten sogenannter Billigflieger. Die Urlaubskosten konnten bei den Reisenden allein durch günstige Flüge erheblich gesenkt werden. Zwar wird von den Billigfluggesellschaften weniger Service im Flieger angeboten, doch dieses Manko nehmen viele Flugtouristen in Kauf. Zumal durch die Möglichkeit, einen Flug online buchen zu können die zusätzlichen Kosten bei der Buchung einer Reise, wie zum Beispiel der Anfahrtsweg zum Reisebüro, entfallen. So bleibt dann gleich mehr Geld in der privaten Reisekasse und der Urlaub kann beginnen.


Finden Routen zwischen Deutsch Städten. Finden Entfernung, Fahrzeit, Kraftstoffkosten von der Route. Alternativen anzeigen Routen. Finden Sie Koordinaten und die Höhe von der Stadt oder Punkt auf Karte. Sie können Höhe von einem Punkt auf der Karte finden, tut ein einfacher Klick. Darüber hinaus dieses Tool Show,...

eingetragen am: 2014-09-22 06:54:31


Lust auf Urlaub? Aber wie sieht es mit der Finanzierung aus? Wir zeigen welche Reiseanbieter die Zahlung der Reisebuchung per Ratenzahlung anbieten und wo Sie mit Kreditvergleichsrechnern den passenden, günstigen Urlaubskredit finden. Erst reisen - dann zahlen. Urlaub mit Ratenzahlung.

eingetragen am: 2017-11-02 12:25:33

Tipps und Top Angebote für Bahnfahrer – Aktuelle Aktionen der Deutschen Bahn und europäischer Züge wie den französischen TGV, Thalys, ÖBB, SBB. Mit den Tipps von und etwas Vorbereitung werden Sie die Bahnfahrt deutlich günstiger genießen.

eingetragen am: 2017-03-09 11:30:28

Fahren Sie stressfrei zum Flughafen Frankfurt, parken Ihr Auto sicher auf unserem Parkplatz und heben gemütlich ab. Nach Ihrer Rückkehr wird ein Mitarbeiter Sie am Terminal in Empfang nehmen und mit dem Shuttelbus zu Ihrem Fahrzeug bringen. Wir wünschen Ihnen erholsame Urlaubtage und freuen uns auf Ihre...

eingetragen am: 2016-08-24 10:30:04

Carlson Wagonlit Travel ist im Bereich Business Travel Management und Meetings & Events global tätig. Wir bieten unseren Kunden hochwertige Lösungen für Ihre Geschäftsreisen und Veranstaltungen. Mit unserer Unterstützung können Sie Ihre Prozesse effizienter gestalten und Ihre Reisekosten senken. Auch...

eingetragen am: 2016-06-13 09:17:35

Follow Us Erlebnisreisen in Berlin ist Ihr Experte für Erlebnis- und Aktivreisen in kleinen Gruppen. Wir bieten Ihnen als unabhängiges Reisebüro eine besondere Auswahl an Aktivurlaub, Abenteuerurlaub und Erlebnisreisen durch die schönsten Länder dieser Welt.

eingetragen am: 2015-03-27 15:53:55

Die Vermittlung von Sprachaufenthalten und Sprachreisen ist eine der Hauptaufgaben der Spracherlebnis Agentur aus Solothurn. Die rasante Entwicklung, hin zu einer offenen Welt und somit die immer grösserer Notwendigkeit von Fremdsprachenkenntnissen sind dabei ebenso ausschlaggebender Punkt wie das Interesse, vor...

eingetragen am: 2014-11-13 19:06:12

Aktuelle Angebote und Tipps zu Flügen, Hotels und allem was dazugehört, um günstig in den Urlaub zu kommen. Daneben gibt es auf verdienter Urlaub Erlebnisberichte von weltweiten Urlaubsreisen mit praktischen Anregungen und Tipps zu tollen Reisezielen und Destinationen.

eingetragen am: 2014-01-19 14:04:42

Articles stellt vor: Pension Frohsinn lädt zu Entspannung, Spaß und Action ein

Familien-Pension Frohsinn, wurde Anfang des 20. Jhd. im österreichischen Bad Gastein erbaut. In der Mitte des Nationalparks Hohe Tauern, 1000 Meter über dem Meeresspiegel, in frischer Bergluft, liegt Bad Gastein. Dieser weltbekannte Kurort bietet eine einmalige Möglichkeit zur Erholung und zum Kräftesammeln in sauberer Bergluft, mit idealem Hochbergklima, Radon-Höhlen und Gasteiner Thermalbädern. 2008 wurde die gesamte Pension Frohsinn saniert.

Artikel wurde eingetragen am: 2010-10-11 07:59:31 stellt vor: Ferien Hotel Riesberghof bietet Natur pur

Das 1994 fertig gestellte Ferienhotel Riesberghof ist ein gutes und preiswertes Mittelklassehotel mit 3 Sternen. Es verfügt über 45 komfortable Gästezimmer, ein gemütliches Restaurant eine Gartenterrasse an. Die Mahlzeiten werden im gemütlichen Restaurant eingenommen. Hier serviert man Gerichte aus der internationalen Küche und bayerisch-böhmische Schmankerl.

Artikel wurde eingetragen am: 2010-10-11 07:55:11

ADP Presseagentur stellt vor: Von Sarrazin und legalen Trickbetrügern

Vermutlich kommt alles daher, dass ich ein ziemlich fauler Mensch bin. Wenn ich schon arbeiten muss, dann will ich es wenigstens für mich tun. Irgendetwas läuft da verdammt falsch mit diesen Steuern, dachte ich mir schon vor vielen Jahren als Lehrling, als sie mir von meinen läppischen 120 Mark auch noch 10 Mark abzogen. Und dafür sollte ich jeden Tag um 6 Uhr früh aufstehen?

Artikel wurde eingetragen am: 2010-10-11 07:46:23 stellt vor: Gelungene Kombination aus Klima, Natur und polnischer Gastfreundschaft

Kormoran Wellness Medical SPA liegt an der einzigen Stelle der Ostsee, wo drei Gewässer- Meer, Fluss und ein See ihre Kräfte vereinigen und eine Regenerations- und Erholungsoase bilden.Hier finden Sie ein einzigartiges Zentrum für biologische Erneuerung. Therapeuten helfen Ihnen, Ihre Vitalkräfte -, Gesundheit – und körperliche und mentale Stärke wieder zu gewinnen.

Artikel wurde eingetragen am: 2010-10-11 07:39:44

Ferienwohnung Thiessow Ruegenurlaub an der Ostsee

Infos zur Ferienwohnung Thiessow - Ruegenurlaub an der Ostsee in unserer Ferienwohnung auf Ruegen. Unsere Ferienwohnung liegt direkt am Ostseestrand und bietet Platz für vier Personen. Für Ihren nächsten Ruegenurlaunb an der Ostsee besuchen Sie unsere Ferienwohnung im Ostseebad Thiessow.

Artikel wurde eingetragen am: 2010-01-16 10:40:43

Ostsee Polen Urlaub – Wellnessoase und Erlebnisreise zugleich

Urlaub in Polen bietet eine besondere Atmosphäre von Ruhe, Wellness und Entspannung. Eine Kurreise an die Ostsee nach Polen ist sowohl für Erholungssuchende als auch für Aktivurlauber der perfekten Urlaubsort zum Wohlfühlen für klein und groß und zu jeder Jahreszeit ...

Artikel wurde eingetragen am: 2009-02-25 11:28:24

Eine Reise machen - allzeit ein Erlebnis

Komplementäre Gebiete die fabelhaft miteinander harmonieren sind Urlaubsvorhaben und Internet. Wer eine Tour in die verschiedenen Teile der Welt macht, will eine Menge dafür bekommen. Zuweilen steht zwar außerdem die Entspannung im Vordergrund, allerdings favorisieren die meisten Menschen doch einen Erlebnisurlaub.

Artikel wurde eingetragen am: 2008-10-31 17:12:05

Ausflugsziele in Landeck

Der folgende Artikel soll den Lesern den Urlaubsort Landeck - unter besonderer Berücksichtigung geeigneter Ausflugsziele – näher bringen, wie beispielsweise das dortige Schloss. Auch Sportbegeisterte kommen in Landeck auf ihre Kosten, Skifahren oder schwimmen im Achensee sollte man unbedingt ausprobieren.

Artikel wurde eingetragen am: 2008-08-26 09:10:21

Städtereisen und Fernreisen - Von Rom bis Bangkok

Lassen Sie mich einen kleinen Beitrag über der Deutschen Lieblingsbeschäftigung, das Reisen, schreiben. Denn das ist und bleibt der Wunsch eines jeden. Und egal ob es sich um Fernreisen, von Städtereisen Europa, Flugreisen Bangkok bis Flugreisen Barcelona geht, es wird immer gereist. Und zwar so viel wie das Geld reicht Wegen der vielen Angebote nur bei den Kosten für den Flug, sowohl wie gewohnt über das Reisebüro als auch mittlerweile mit einem Klick online über das Internet, gibt es für den Urlauber ein Überangebot an Reiseangeboten.

Artikel wurde eingetragen am: 2008-06-01 12:03:44

Spottbillig reisen- Tickets im www

Thailand mit seinen Nachbarn Laos, Kambodscha und Vietnam - keine Region auf der Erde hat sich so rasant zu einem so anziehenden Reiseziel für nahezu jede Zielgruppe entfaltet. Die südostasiatischen Länder sind zudem daneben eine fabelhafte Basis, um etwa daneben in das Gebiet von Burma (das frühere Myanmar) und ins wunderbare Malaysia weiterzupendeln.

Artikel wurde eingetragen am: 2008-06-01 11:34:09

Mallorca De

Der Mallorca Reiseführer ist ein hilfreiches Web - Angebot für die nächste Urlaubsplanung auf der größten spanischen Baleareninsel. Mallorca - Interessierte erfahren hier alle wichtigen Informationen über die beliebte Ferieninsel. In den einzelnen Rubriken werden Tipps zu schönen Sand- und Felsenstränden, zu interessanten Sehenswürdigkeiten und Städten gegeben, und wo man einen spaßigen Tag mit Kindern im Freizeitpark erleben kann. Weiterhin werden hilfreiche Hinweise zu Klettergebieten im Gebirge gegeben. Die interessantesten Sehenswürdigkeiten und Orte werden in eigenen Rubriken detailliert beschrieben, wie z.B. Cap de Formentor oder Kloster Lluc und natürlich die vielen alten Höhlen, die man besichtigen kann.

Artikel wurde eingetragen am: 2008-02-04 13:53:46

E-Piano kaufen oder Klavier kaufen
Seite zum Thema E-Piano kaufen oder Klavier kaufen. Mit Tipps und vielen Erklärungen zu [...]

  Ein Backlink-Partner: Skandinavien Shop Nordicfeeling .... Skandinavische Tradition und Innovation in einem Shop. Neben landestypischen Produkten aus Glas, Holz und Textil, finden Sie in unserem Shopsortiment auch Armbänder aus Rentierleder, Silberanhänger, Kuschel Elche für die Kleinen, Kerzen und Leuchter.